Recombinant Human APOC1 protein, GST-tagged

• Cat.No.: APOC1-704H
• Product Overview: Human APOC1 full-length ORF ( AAH09698, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.87 kDa
• AA Sequence: MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOC1 apolipoprotein C-I [ Homo sapiens ]
• Official Symbol: APOC1
• Synonyms: APOC1; apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1
• Gene ID: 341
• mRNA Refseq: NM_001645
• Protein Refseq: NP_001636
• MIM: 107710
• UniProt ID: P02654