Recombinant Human APOC1 protein, GST-tagged
Cat.No. : | APOC1-704H |
Product Overview : | Human APOC1 full-length ORF ( AAH09698, 1 a.a. - 83 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 34.87 kDa |
AA Sequence : | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOC1 apolipoprotein C-I [ Homo sapiens ] |
Official Symbol | APOC1 |
Synonyms | APOC1; apolipoprotein C-I; apo-CIB; apoC-IB; apolipoprotein C1; |
Gene ID | 341 |
mRNA Refseq | NM_001645 |
Protein Refseq | NP_001636 |
MIM | 107710 |
UniProt ID | P02654 |
◆ Recombinant Proteins | ||
APOC1-4903H | Recombinant Human Apolipoprotein C-I | +Inquiry |
Apoc1-303M | Recombinant Mouse Apoc1 protein, His-GST-tagged | +Inquiry |
APOC1-2536H | Recombinant Human APOC1 protein, His-SUMO-tagged | +Inquiry |
APOC1-220H | Recombinant Human APOC1 Protein, His&GST-tagged | +Inquiry |
APOC1-2474H | Recombinant Human APOC1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
APOC1-8038H | Native Human ApoLipoprotein CI | +Inquiry |
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
APOC1-27330TH | Native Human APOC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC1-97HCL | Recombinant Human APOC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOC1 Products
Required fields are marked with *
My Review for All APOC1 Products
Required fields are marked with *
0
Inquiry Basket