Recombinant Human APOBEC3F protein, GST-tagged

• Cat.No.: APOBEC3F-700H
• Product Overview: Human APOBEC3F full-length ORF ( NP_001006667.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 38.2 kDa
• AA Sequence: MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOBEC3F apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F [ Homo sapiens ]
• Official Symbol: APOBEC3F
• Synonyms: APOBEC3F; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F; DNA dC->dU-editing enzyme APOBEC-3F; ARP8; BK150C2.4.MRNA; KA6; DNA dC-> dU-editing enzyme APOBEC-3F; induced upon T-cell activation; apolipoprotein B mRNA editing enzyme cytidine deaminase; apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F; MGC74891
• Gene ID: 200316
• mRNA Refseq: NM_001006666
• Protein Refseq: NP_001006667
• MIM: 608993
• UniProt ID: Q8IUX4