Recombinant Human APOBEC3F protein, GST-tagged
Cat.No. : | APOBEC3F-700H |
Product Overview : | Human APOBEC3F full-length ORF ( NP_001006667.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 38.2 kDa |
AA Sequence : | MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOBEC3F apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F [ Homo sapiens ] |
Official Symbol | APOBEC3F |
Synonyms | APOBEC3F; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F; DNA dC->dU-editing enzyme APOBEC-3F; ARP8; BK150C2.4.MRNA; KA6; DNA dC-> dU-editing enzyme APOBEC-3F; induced upon T-cell activation; apolipoprotein B mRNA editing enzyme cytidine deaminase; apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F; MGC74891; |
Gene ID | 200316 |
mRNA Refseq | NM_001006666 |
Protein Refseq | NP_001006667 |
MIM | 608993 |
UniProt ID | Q8IUX4 |
◆ Recombinant Proteins | ||
APOBEC3F-1575H | Recombinant Human APOBEC3F protein | +Inquiry |
APOBEC3F-193R | Recombinant Rhesus Macaque APOBEC3F Protein, His (Fc)-Avi-tagged | +Inquiry |
APOBEC3F-147H | Recombinant Human APOBEC3F Protein, His-tagged | +Inquiry |
APOBEC3F-1411HF | Recombinant Full Length Human APOBEC3F Protein, GST-tagged | +Inquiry |
APOBEC3F-700H | Recombinant Human APOBEC3F protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOBEC3F-8785HCL | Recombinant Human APOBEC3F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOBEC3F Products
Required fields are marked with *
My Review for All APOBEC3F Products
Required fields are marked with *
0
Inquiry Basket