Recombinant Human APOB protein, GST-tagged

• Cat.No.: APOB-128H
• Product Overview: Recombinant Human APOB(28 a.a. - 127 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 28-127 a.a.
• Description: This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEV YGFNPEGKALLKKTKNSEEFAAAMS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: APOB apolipoprotein B (including Ag(x) antigen) [ Homo sapiens ]
• Official Symbol: APOB
• Synonyms: APOB; apolipoprotein B (including Ag(x) antigen); apolipoprotein B-100; apoB-48; apoB-100; apo B-100; mutant Apo B 100; apolipoprotein B48; FLDB; LDLCQ4
• Gene ID: 338
• mRNA Refseq: NM_000384
• Protein Refseq: NP_000375
• UniProt ID: P04114
• Chromosome Location: 2p24-p23
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Chylomicron-mediated lipid transport, organism-specific biosystem; FOXA1 transcription factor network, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Hemostasis, organism-specific biosystem; LDL-mediated lipid transport, organism-specific biosystem
• Function: cholesterol transporter activity; enzyme binding; heparin binding; lipid transporter activity; low-density lipoprotein particle receptor binding; phospholipid binding; protein heterodimerization activity