Recombinant Human API5 protein, GST-tagged

• Cat.No.: API5-681H
• Product Overview: Human API5 partial ORF ( AAH17709, 400 a.a. - 504 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an apoptosis inhibitory protein whose expression prevents apoptosis after growth factor deprivation. This protein suppresses the transcription factor E2F1-induced apoptosis and also interacts with, and negatively regulates Acinus, a nuclear factor involved in apoptotic DNA fragmentation. Its depletion enhances the cytotoxic action of the chemotherapeutic drugs. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.18 kDa
• AA Sequence: GEALKTEENKIKVVALKITNNINVLIKDLFHIPPSYKSTVTLSWKPVQKVEIGQKRASEDTTSGSPPKKSSAGPKRDARQIYNPPSGKYSSNLGNFNYERSLQGK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: API5 apoptosis inhibitor 5 [ Homo sapiens ]
• Official Symbol: API5
• Synonyms: API5; apoptosis inhibitor 5; AAC 11; AAC11; API5 like 1; API5L1; fibroblast growth factor 2 interacting factor 2; migration inducing protein MIG8; FIF; antiapoptosis clone 11 protein; migration-inducing protein MIG8; cell migration-inducing gene 8 protein; fibroblast growth factor 2-interacting factor 2; AAC-11; FLJ11587
• Gene ID: 8539
• mRNA Refseq: NM_001142930
• Protein Refseq: NP_001136402
• MIM: 609774
• UniProt ID: Q9BZZ5