Recombinant Human APEG1 protein, GST-tagged

• Cat.No.: APEG1-675H
• Product Overview: Human APEG1 full-length ORF ( AAH06346, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein with similarity to members of the myosin light chain kinase family. This protein family is required for myocyte cytoskeletal development. Along with the desmin gene, expression of this gene may be controlled by the desmin locus control region. Mutations in this gene are associated with centronuclear myopathy 5. [provided by RefSeq, Jun 2016]
• Molecular Mass: 38.17 kDa
• AA Sequence: MKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVVSWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVRGE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPEG SPEG complex locus [ Homo sapiens ]
• Official Symbol: SPEG
• Synonyms: SPEG; SPEG complex locus; aortic preferentially expressed gene 1 , APEG1; striated muscle preferentially expressed protein kinase; BPEG; KIAA1297; MGC12676; SPEGalpha; SPEGbeta; aortic preferentially expressed gene 1; aortic preferentially expressed protein 1; nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury; APEG1; APEG-1
• Gene ID: 10290
• mRNA Refseq: NM_001173476
• Protein Refseq: NP_001166947
• UniProt ID: Q15772