Recombinant Human SPEG protein, GST-tagged
Cat.No. : | SPEG-3520H |
Product Overview : | Recombinant Human SPEG protein(Q15772)(1-113aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-113aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.7 kDa |
AA Sequence : | MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SPEG SPEG complex locus [ Homo sapiens ] |
Official Symbol | SPEG |
Synonyms | SPEG; SPEG complex locus; aortic preferentially expressed gene 1 , APEG1; striated muscle preferentially expressed protein kinase; BPEG; KIAA1297; MGC12676; SPEGalpha; SPEGbeta; aortic preferentially expressed gene 1; aortic preferentially expressed protein 1; nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury; APEG1; APEG-1; |
Gene ID | 10290 |
mRNA Refseq | NM_001173476 |
Protein Refseq | NP_001166947 |
UniProt ID | Q15772 |
◆ Recombinant Proteins | ||
APEG1-675H | Recombinant Human APEG1 protein, GST-tagged | +Inquiry |
SPEG-3520H | Recombinant Human SPEG protein, GST-tagged | +Inquiry |
SPEG-8636M | Recombinant Mouse SPEG Protein, His (Fc)-Avi-tagged | +Inquiry |
SPEG-1639Z | Recombinant Zebrafish SPEG | +Inquiry |
SPEG-1118HF | Recombinant Full Length Human SPEG Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPEG-1680HCL | Recombinant Human SPEG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPEG Products
Required fields are marked with *
My Review for All SPEG Products
Required fields are marked with *
0
Inquiry Basket