Recombinant Human SPEG protein, GST-tagged

• Cat.No.: SPEG-3520H
• Product Overview: Recombinant Human SPEG protein(Q15772)(1-113aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-113aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.7 kDa
• AA Sequence: MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDVRLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SPEG SPEG complex locus [ Homo sapiens ]
• Official Symbol: SPEG
• Synonyms: SPEG; SPEG complex locus; aortic preferentially expressed gene 1 , APEG1; striated muscle preferentially expressed protein kinase; BPEG; KIAA1297; MGC12676; SPEGalpha; SPEGbeta; aortic preferentially expressed gene 1; aortic preferentially expressed protein 1; nuclear protein, marker for differentiated aortic smooth muscle and down-regulated with vascular injury; APEG1; APEG-1
• Gene ID: 10290
• mRNA Refseq: NM_001173476
• Protein Refseq: NP_001166947
• UniProt ID: Q15772