Recombinant Human APCS protein, GST-tagged

• Cat.No.: APCS-674H
• Product Overview: Human APCS partial ORF ( NP_001630, 117 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.51 kDa
• AA Sequence: WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APCS amyloid P component, serum [ Homo sapiens ]
• Official Symbol: APCS
• Synonyms: APCS; amyloid P component, serum; serum amyloid P-component; 9.5S alpha 1 glycoprotein; MGC88159; pentaxin related; PTX2; SAP; pentaxin-related; 9.5S alpha-1-glycoprotein
• Gene ID: 325
• mRNA Refseq: NM_001639
• Protein Refseq: NP_001630
• MIM: 104770
• UniProt ID: P02743