Recombinant Human APCS protein, GST-tagged
Cat.No. : | APCS-674H |
Product Overview : | Human APCS partial ORF ( NP_001630, 117 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.51 kDa |
AA Sequence : | WESSSGIAEFWINGTPLVKKGLRQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APCS amyloid P component, serum [ Homo sapiens ] |
Official Symbol | APCS |
Synonyms | APCS; amyloid P component, serum; serum amyloid P-component; 9.5S alpha 1 glycoprotein; MGC88159; pentaxin related; PTX2; SAP; pentaxin-related; 9.5S alpha-1-glycoprotein; |
Gene ID | 325 |
mRNA Refseq | NM_001639 |
Protein Refseq | NP_001630 |
MIM | 104770 |
UniProt ID | P02743 |
◆ Recombinant Proteins | ||
Apcs-585M | Active Recombinant Mouse Apcs protein(Met1-Asp224), His-tagged | +Inquiry |
APCS-2526H | Recombinant Human APCS protein | +Inquiry |
Apcs-6768M | Recombinant Mouse Apcs Protein (Gln21-Asp224), C-His tagged | +Inquiry |
Apcs-5743M | Recombinant Mouse Apcs protein, hFc-tagged | +Inquiry |
APCS-728M | Recombinant Mouse APCS Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APCS-8258H | Native Human Serum Amyloid P | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
◆ Cell & Tissue Lysates | ||
APCS-1269HCL | Recombinant Human APCS cell lysate | +Inquiry |
APCS-1761RCL | Recombinant Rat APCS cell lysate | +Inquiry |
APCS-3089MCL | Recombinant Mouse APCS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APCS Products
Required fields are marked with *
My Review for All APCS Products
Required fields are marked with *
0
Inquiry Basket