Recombinant Human APBA2 protein, GST-tagged

• Cat.No.: APBA2-667H
• Product Overview: Human APBA2 full-length ORF (BAC85951.1, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the X11 protein family. It is a neuronal adapter protein that interacts with the Alzheimer's disease amyloid precursor protein (APP). It stabilizes APP and inhibits production of proteolytic APP fragments including the A beta peptide that is deposited in the brains of Alzheimer's disease patients. This gene product is believed to be involved in signal transduction processes. It is also regarded as a putative vesicular trafficking protein in the brain that can form a complex with the potential to couple synaptic vesicle exocytosis to neuronal cell adhesion. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 53.24 kDa
• AA Sequence: MAVIPESAWKHPDYVDDGLSGVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKNSEGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGAQEGKKQYKMICHVFESEDVSKPLPGHSPPKVHSPGRLQDPGAVETTLRWKASMLLLMFPVDQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APBA2 amyloid beta (A4) precursor protein-binding, family A, member 2 [ Homo sapiens ]
• Official Symbol: APBA2
• Synonyms: APBA2; amyloid beta (A4) precursor protein-binding, family A, member 2; amyloid beta (A4) precursor protein binding, family A, member 2 (X11 like) , MINT2, X11 like , X11L; amyloid beta A4 precursor protein-binding family A member 2; D15S1518E; HsT16821; LIN 10; MGC:14091; mint-2; X11-like protein; adapter protein X11beta; neuron-specific X11L protein; neuronal munc18-1-interacting protein 2; phosphotyrosine-binding/-interacting domain (PTB)-bearing protein; amyloid beta (A4) precursor protein-binding, family A, member 2 (X11-like); X11L; MINT2; LIN-10; X11-BETA; MGC99508
• Gene ID: 321
• mRNA Refseq: NM_001130414
• Protein Refseq: NP_001123886
• MIM: 602712
• UniProt ID: Q99767