Recombinant Human AP2M1 protein, His-tagged

Cat.No. : AP2M1-2694H
Product Overview : Recombinant Human AP2M1 protein(1-108 aa), fused to His tag, was expressed in E. coli.
Availability April 19, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-108 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name AP2M1 adaptor-related protein complex 2, mu 1 subunit [ Homo sapiens ]
Official Symbol AP2M1
Synonyms AP2M1; adaptor-related protein complex 2, mu 1 subunit; CLAPM1; AP-2 complex subunit mu; AP 2 mu 2 chain; AP50; clathrin adaptor complex AP2; mu subunit; clathrin assembly protein complex 2 medium chain; clathrin coat adaptor protein AP50; clathrin associated/assembly/adaptor protein; medium 1; HA2 50 kDA subunit; mu2; plasma membrane adaptor AP 2 50kDA protein; adaptin-mu2; AP-2 mu chain; AP-2 mu 2 chain; clathrin coat assembly protein AP50; clathrin coat-associated protein AP50; adaptor protein complex AP-2 subunit mu; clathrin adaptor complex AP2, mu subunit; plasma membrane adaptor AP-2 50kDA protein; plasma membrane adaptor AP-2 50 kDa protein; adapter-related protein complex 2 mu subunit; clathrin-associated/assembly/adaptor protein, medium 1;
Gene ID 1173
mRNA Refseq NM_001025205
Protein Refseq NP_001020376
MIM 601024
UniProt ID Q96CW1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AP2M1 Products

Required fields are marked with *

My Review for All AP2M1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon