Recombinant Human AP2M1 protein, His-tagged

• Cat.No.: AP2M1-2694H
• Product Overview: Recombinant Human AP2M1 protein(1-108 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-108 aa
• AA Sequence: MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: AP2M1 adaptor-related protein complex 2, mu 1 subunit [ Homo sapiens ]
• Official Symbol: AP2M1
• Synonyms: AP2M1; adaptor-related protein complex 2, mu 1 subunit; CLAPM1; AP-2 complex subunit mu; AP 2 mu 2 chain; AP50; clathrin adaptor complex AP2; mu subunit; clathrin assembly protein complex 2 medium chain; clathrin coat adaptor protein AP50; clathrin associated/assembly/adaptor protein; medium 1; HA2 50 kDA subunit; mu2; plasma membrane adaptor AP 2 50kDA protein; adaptin-mu2; AP-2 mu chain; AP-2 mu 2 chain; clathrin coat assembly protein AP50; clathrin coat-associated protein AP50; adaptor protein complex AP-2 subunit mu; clathrin adaptor complex AP2, mu subunit; plasma membrane adaptor AP-2 50kDA protein; plasma membrane adaptor AP-2 50 kDa protein; adapter-related protein complex 2 mu subunit; clathrin-associated/assembly/adaptor protein, medium 1
• Gene ID: 1173
• mRNA Refseq: NM_001025205
• Protein Refseq: NP_001020376
• MIM: 601024
• UniProt ID: Q96CW1