Recombinant Human ANXA2R protein, GST-tagged
Cat.No. : | ANXA2R-632H |
Product Overview : | Human ANXA2R full-length ORF ( NP_001014301.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | ANXA2R (Annexin A2 Receptor) is a Protein Coding gene. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 48.1 kDa |
AA Sequence : | MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANXA2R annexin A2 receptor [ Homo sapiens (human) ] |
Official Symbol | ANXA2R |
Synonyms | ANXA2R; annexin A2 receptor; AX2R; AXIIR; C5orf39; annexin-2 receptor; annexin II receptor |
Gene ID | 389289 |
mRNA Refseq | NM_001014279 |
Protein Refseq | NP_001014301 |
MIM | 611296 |
UniProt ID | Q3ZCQ2 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ANXA2R Products
Required fields are marked with *
My Review for All ANXA2R Products
Required fields are marked with *
0
Inquiry Basket