Recombinant Human ANXA2R protein, GST-tagged

• Cat.No.: ANXA2R-632H
• Product Overview: Human ANXA2R full-length ORF ( NP_001014301.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANXA2R (Annexin A2 Receptor) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 48.1 kDa
• AA Sequence: MEQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDSCDLGLLSSPCWRLPGVYWQNGLSPGVQSTLEPSTAKPTEFSWPGTQKQQEAPVEEVGQAEEPDRLRLQQLPWSSPLHPWDRQQDTEVCDSGCLLERRHPPALQPWRHLPGFSDCLEWILRVGFAAFSVLWACCSRICGAKQP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANXA2R annexin A2 receptor [ Homo sapiens (human) ]
• Official Symbol: ANXA2R
• Synonyms: ANXA2R; annexin A2 receptor; AX2R; AXIIR; C5orf39; annexin-2 receptor; annexin II receptor
• Gene ID: 389289
• mRNA Refseq: NM_001014279
• Protein Refseq: NP_001014301
• MIM: 611296
• UniProt ID: Q3ZCQ2