Recombinant Human ANXA2 protein(111-210 aa), C-His-tagged

• Cat.No.: ANXA2-2583H
• Product Overview: Recombinant Human ANXA2 protein(P07355)(111-210 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 111-210 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 13.5 kDa
• AASequence: ASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ANXA2 annexin A2 [ Homo sapiens ]
• Official Symbol: ANXA2
• Synonyms: ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV
• Gene ID: 302
• mRNA Refseq: NM_001002857
• Protein Refseq: NP_001002857
• MIM: 151740
• UniProt ID: P07355