Recombinant Full Length Human ANXA2 Protein, C-Flag-tagged

Cat.No. : ANXA2-591HFL
Product Overview : Recombinant Full Length Human ANXA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 38.4 kDa
AA Sequence : MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQD IAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQEL QEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDV PKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKG
KGTRDKVLIRIMASRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Secreted Protein, Stem cell - Pluripotency
Full Length : Full L.
Gene Name ANXA2 annexin A2 [ Homo sapiens (human) ]
Official Symbol ANXA2
Synonyms P36; ANX2; LIP2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV; HEL-S-270
Gene ID 302
mRNA Refseq NM_001002857.2
Protein Refseq NP_001002857.1
MIM 151740
UniProt ID P07355

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANXA2 Products

Required fields are marked with *

My Review for All ANXA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon