Recombinant Human ANTXR1, His-tagged
Cat.No. : | ANTXR1-38H |
Product Overview : | Recombinant Human Anthrax Toxin Receptor 1/ANTXR1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu33-Ser321) of Human ANTXR1 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 33-321 a.a. |
Description : | Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothelial cells. ANTXR1 plays a role in cell attachment and migration. ANTXR1 interacts with extracellular matrix proteins and the actin cytoskeleton, it mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. It is also involved in the angiogenic response of cultured umbilical vein endothelial cells, up-regulated in cultured angiogenic umbilical vein endothelial cells. Defects in ANTXR1 are associated with susceptibility to hemangioma capillary infantile (HCI). |
AA Sequence : | EDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTE DREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRTASVIIALTDGELHEDLFFYSE REANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAE PSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMK AALQVSMNDGLSFISSSVIITTTHCSLHKVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | ANTXR1 anthrax toxin receptor 1 [ Homo sapiens ] |
Official Symbol | ANTXR1 |
Synonyms | ANTXR1; anthrax toxin receptor 1; anthrax toxin receptor; ATR; FLJ10601; FLJ21776; TEM8; tumor endothelial marker 8 precursor; 2310008J16Rik; 2810405N18Rik; tumor endothelial marker 8; FLJ11298; |
Gene ID | 84168 |
mRNA Refseq | NM_018153 |
Protein Refseq | NP_060623 |
MIM | 606410 |
UniProt ID | Q9H6X2 |
Chromosome Location | 2p13.1 |
Pathway | Cellular roles of Anthrax toxin, organism-specific biosystem; |
Function | actin filament binding; collagen binding; metal ion binding; protein binding; receptor activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
ANTXR1-2158H | Recombinant Human ANTXR1 Protein, MYC/DDK-tagged | +Inquiry |
ANTXR1-687R | Recombinant Rat ANTXR1 Protein | +Inquiry |
ANTXR1-1707M | Recombinant Mouse ANTXR1 Protein | +Inquiry |
Antxr1-4985M | Recombinant Mouse Antxr1 protein, His-tagged | +Inquiry |
ANTXR1-2069M | Recombinant Mouse ANTXR1 Protein (31-319 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANTXR1-1463HCL | Recombinant Human ANTXR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANTXR1 Products
Required fields are marked with *
My Review for All ANTXR1 Products
Required fields are marked with *
0
Inquiry Basket