Recombinant Human ANTXR1, His-tagged

• Cat.No.: ANTXR1-38H
• Product Overview: Recombinant Human Anthrax Toxin Receptor 1/ANTXR1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu33-Ser321) of Human ANTXR1 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 33-321 a.a.
• Description: Anthrax Toxin Receptor 1 (ANTXR1) is a single-pass type I membrane protein that belongs to the ATR family. ANTXR1 contains one VWFA domain and binds PA through the VWA domain. ANTXR1 is highly expressed in tumor endothelial cells. ANTXR1 plays a role in cell attachment and migration. ANTXR1 interacts with extracellular matrix proteins and the actin cytoskeleton, it mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. It is also involved in the angiogenic response of cultured umbilical vein endothelial cells, up-regulated in cultured angiogenic umbilical vein endothelial cells. Defects in ANTXR1 are associated with susceptibility to hemangioma capillary infantile (HCI).
• AA Sequence: EDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTE DREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRTASVIIALTDGELHEDLFFYSE REANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAE PSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMK AALQVSMNDGLSFISSSVIITTTHCSLHKVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: ANTXR1 anthrax toxin receptor 1 [ Homo sapiens ]
• Official Symbol: ANTXR1
• Synonyms: ANTXR1; anthrax toxin receptor 1; anthrax toxin receptor; ATR; FLJ10601; FLJ21776; TEM8; tumor endothelial marker 8 precursor; 2310008J16Rik; 2810405N18Rik; tumor endothelial marker 8; FLJ11298
• Gene ID: 84168
• mRNA Refseq: NM_018153
• Protein Refseq: NP_060623
• MIM: 606410
• UniProt ID: Q9H6X2
• Chromosome Location: 2p13.1
• Pathway: Cellular roles of Anthrax toxin, organism-specific biosystem
• Function: actin filament binding; collagen binding; metal ion binding; protein binding; receptor activity; transmembrane signaling receptor activity