Recombinant Human ANO10 Protein, GST-tagged

• Cat.No.: ANO10-4216H
• Product Overview: Human FLJ10375 full-length ORF ( AAH38855, 1 a.a. - 392 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The transmembrane protein encoded by this gene belongs to the anoctamin family of calcium-activated chloride channels, also known as the transmembrane 16 family. The encoded protein contains eight transmembrane domains with cytosolic N- and C-termini. Defects in this gene may cause autosomal recessive spinocerebellar ataxia-10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 68.86 kDa
• AA Sequence: MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIENHRLESAYQNHLILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFEMMSVISVVTNCALIGMSPQVNAAFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQMKLVTENLKEEPMESGKEKAT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANO10 anoctamin 10 [ Homo sapiens ]
• Official Symbol: ANO10
• Synonyms: ANO10; anoctamin 10; TMEM16K, transmembrane protein 16K; anoctamin-10; FLJ10375; MGC47890; SCAR10; transmembrane protein 16K; TMEM16K
• Gene ID: 55129
• mRNA Refseq: NM_001204831
• Protein Refseq: NP_001191760
• MIM: 613726
• UniProt ID: Q9NW15