Recombinant Human ANO1 protein, His&Myc-tagged

Cat.No. : ANO1-4534H
Product Overview : Recombinant Human ANO1 protein(Q5XXA6)(806-892aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 806-892aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.6 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLA
Gene Name ANO1 anoctamin 1, calcium activated chloride channel [ Homo sapiens ]
Official Symbol ANO1
Synonyms ANO1; anoctamin 1, calcium activated chloride channel; oral cancer overexpressed 2 , ORAOV2, TMEM16A, transmembrane protein 16A; anoctamin-1; DOG1; FLJ10261; TAOS2; oral cancer overexpressed 2; tumor-amplified and overexpressed sequence 2; discovered on gastrointestinal stromal tumors protein 1; transmembrane protein 16A (eight membrane-spanning domains); ORAOV2; TMEM16A;
Gene ID 55107
mRNA Refseq NM_018043
Protein Refseq NP_060513
MIM 610108
UniProt ID Q5XXA6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANO1 Products

Required fields are marked with *

My Review for All ANO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon