Recombinant Human ANKRD49 protein, GST-tagged

• Cat.No.: ANKRD49-601H
• Product Overview: Human ANKRD49 full-length ORF ( NP_060174.2, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANKRD49 (Ankyrin Repeat Domain 49) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 53.7 kDa
• AA Sequence: MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD49 ankyrin repeat domain 49 [ Homo sapiens ]
• Official Symbol: ANKRD49
• Synonyms: ANKRD49; ankyrin repeat domain 49; ankyrin repeat domain-containing protein 49; FGIF; FLJ20189; GBIF; fetal globin-inducing factor; FLJ20441
• Gene ID: 54851
• mRNA Refseq: NM_017704
• Protein Refseq: NP_060174
• UniProt ID: Q8WVL7