Recombinant Human ANKRD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ANKRD2-5117H
• Product Overview: ANKRD2 MS Standard C13 and N15-labeled recombinant protein (NP_001123453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 36 kDa
• AA Sequence: MAKAPSWAGVGALAYKAPEALWPAEAVMDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKEGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ANKRD2 ankyrin repeat domain 2 [ Homo sapiens (human) ]
• Official Symbol: ANKRD2
• Synonyms: ANKRD2; ankyrin repeat domain 2 (stretch responsive muscle); ankyrin repeat domain-containing protein 2; ARPP; hArpp; ankyrin-repeat protein; skeletal muscle ankyrin repeat protein; MGC104314
• Gene ID: 26287
• mRNA Refseq: NM_001129981
• Protein Refseq: NP_001123453
• MIM: 610734
• UniProt ID: Q9GZV1