Recombinant Human ANKRD2 protein, GST-tagged

• Cat.No.: ANKRD2-580H
• Product Overview: Human ANKRD2 full-length ORF (BAG37301.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that belongs to the muscle ankyrin repeat protein (MARP) family. A similar gene in rodents is a component of a muscle stress response pathway and plays a role in the stretch-response associated with slow muscle function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 63.03 kDa
• AA Sequence: MDGTMEDSEAVQRATALIEQRLAQEEENEKLRGDTRQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAASHEPPPEPEEITGPVDEETFLKAAVEGKMKVIEKFLADGGSADTCDQFRRTALHRASLEGHMEILEKLLDNGATVDFQDRLDCTAMHWACRGGHLEVVKLLQSHGADTNVRDKLLSTPLHVAVRTGQVEIVEHFLSLGLEINARDREGDTALHDAVRLNRYKIIKLLLLHGADMMTKNLAGKTPTDLVQLWQADTRHALEHPEPGAEHNGLEGPNDSGRETPQPVPAQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD2 ankyrin repeat domain 2 (stretch responsive muscle) [ Homo sapiens ]
• Official Symbol: ANKRD2
• Synonyms: ANKRD2; ankyrin repeat domain 2 (stretch responsive muscle); ankyrin repeat domain-containing protein 2; ARPP; hArpp; ankyrin-repeat protein; skeletal muscle ankyrin repeat protein; MGC104314
• Gene ID: 26287
• mRNA Refseq: NM_001129981
• Protein Refseq: NP_001123453
• MIM: 610734
• UniProt ID: Q9GZV1