Recombinant Human ANKRD16 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ANKRD16-6174H
• Product Overview: ANKRD16 MS Standard C13 and N15-labeled recombinant protein (NP_001009941) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: ANKRD16 (Ankyrin Repeat Domain 16) is a Protein Coding gene. An important paralog of this gene is ASB1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 39.3 kDa
• AA Sequence: MAQPGDPRRLCRLVQEGRLRALKEELQAAGGCPGPAGDTLLHCAARHGHRDVLAYLAEAWGMDIEATNRDYKRPLHEAASMGHRDCVRYLLGRGAAVDCLKKADWTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLLKRCQYEPDYRDNCGVTALMDAIQCGHIDVARLLLDEHGACLSAEDSLGAQALHRAAVTGQDEAIRFLVSELGVDVDVRATSTHLTALHYAAKEGHTSTIQTLLSLGADINSKDEKNRSALHLACAGQHLACAKFLLQSGLKDSEDITGTLAQQLPRRADVLQGSGHSAMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ANKRD16 ankyrin repeat domain 16 [ Homo sapiens (human) ]
• Official Symbol: ANKRD16
• Synonyms: ANKRD16; ankyrin repeat domain 16; ankyrin repeat domain-containing protein 16
• Gene ID: 54522
• mRNA Refseq: NM_001009941
• Protein Refseq: NP_001009941
• MIM: 618017
• UniProt ID: Q6P6B7