Recombinant Human ANGPTL4 Protein, FLAG-tagged

• Cat.No.: ANGPTL4-102H
• Product Overview: Human ANGPTL4 (Total 392 AA) recombinant protein with C-Terminal Flag-tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Molecular Mass: 44.2 kDa (calculated)
• AA Sequence: GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASAAADYKDDDDK
• Endotoxin: < 1.0 EU/ug
• Purity: Purity as determined by densitometric image analysis: >90%
• Applications: WB, ELISA, Cell culture and/or animal studies
• Quality Control Test: BCA to determine quantity of the protein.
  SDS PAGE to determine purity of the protein.
  LAL to determine quantity of endotoxin.
• Notes: This product is intended for research use only.
• Storage: Store the lyophilized protein at –80 centigrade. Lyophilized protein remains stable until the expiry date when stored at –80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
• Storage Buffer: Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4
• Reconstitution: Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.

Gene Information

• Gene Name: ANGPTL4 angiopoietin like 4 [ Homo sapiens (human) ]
• Official Symbol: ANGPTL4
• Synonyms: ANGPTL4; angiopoietin like 4; FIAF; NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158; angiopoietin-related protein 4; PPARG angiopoietin related protein; fasting-induced adipose factor; hepatic angiopoietin-related protein; hepatic fibrinogen/angiopoietin-related protein; peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein
• Gene ID: 51129
• mRNA Refseq: NM_001039667
• Protein Refseq: NP_001034756
• MIM: 605910
• UniProt ID: Q9BY76