Recombinant Human ANGPTL4 Protein, FLAG-tagged

Cat.No. : ANGPTL4-102H
Product Overview : Human ANGPTL4 (Total 392 AA) recombinant protein with C-Terminal Flag-tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Molecular Mass : 44.2 kDa (calculated)
AA Sequence : GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASAAADYKDDDDK
Endotoxin : < 1.0 EU/ug
Purity : Purity as determined by densitometric image analysis: >90%
Applications : WB, ELISA, Cell culture and/or animal studies
Quality Control Test : BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Notes : This product is intended for research use only.
Storage : Store the lyophilized protein at –80 centigrade. Lyophilized protein remains stable until the expiry date when stored at –80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
Storage Buffer : Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4
Reconstitution : Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
Gene Name ANGPTL4 angiopoietin like 4 [ Homo sapiens (human) ]
Official Symbol ANGPTL4
Synonyms ANGPTL4; angiopoietin like 4; FIAF; NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158; angiopoietin-related protein 4; PPARG angiopoietin related protein; fasting-induced adipose factor; hepatic angiopoietin-related protein; hepatic fibrinogen/angiopoietin-related protein; peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein
Gene ID 51129
mRNA Refseq NM_001039667
Protein Refseq NP_001034756
MIM 605910
UniProt ID Q9BY76

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANGPTL4 Products

Required fields are marked with *

My Review for All ANGPTL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon