Recombinant Human ANGPTL1 protein, GST-tagged
Cat.No. : | ANGPTL1-553H |
Product Overview : | Human ANGPTL1 full-length ORF ( AAH50640, 24 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 77.22 kDa |
AA Sequence : | GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANGPTL1 angiopoietin-like 1 [ Homo sapiens ] |
Official Symbol | ANGPTL1 |
Synonyms | ANGPTL1; angiopoietin-like 1; ANGPT3; angiopoietin-related protein 1; ANG3; angioarrestin; AngY; ARP1; ANG-3; angiopoietin 3; angiopoietin-3; angiopoietin Y1; angiopoietin-like protein 1; dJ595C2.2 (angiopoietin Y1); UNQ162; dJ595C2.2; KIAA0351; |
Gene ID | 9068 |
mRNA Refseq | NM_004673 |
Protein Refseq | NP_004664 |
MIM | 603874 |
UniProt ID | O95841 |
◆ Recombinant Proteins | ||
ANGPTL1-0212H | Recombinant Human ANGPTL1 Protein (Phe271-Asp491), His-tagged | +Inquiry |
Angptl1-10521M | Recombinant Mouse Angptl1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL1-5043C | Recombinant Chicken ANGPTL1 | +Inquiry |
ANGPTL1-529M | Recombinant Mouse ANGPTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPTL1-534H | Recombinant Human ANGPTL1 Protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL1-001CCL | Recombinant Canine ANGPTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANGPTL1 Products
Required fields are marked with *
My Review for All ANGPTL1 Products
Required fields are marked with *
0
Inquiry Basket