Recombinant Human ANGPT4 protein, GST-tagged

• Cat.No.: ANGPT4-552H
• Product Overview: Human ANGPT4 partial ORF ( NP_057069, 25 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis is thought to involve regulation of endothelial cell interactions with supporting perivascular cells. The protein encoded by this gene functions as an agonist and is an angiopoietin. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.31 kDa
• AA Sequence: TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANGPT4 angiopoietin 4 [ Homo sapiens ]
• Official Symbol: ANGPT4
• Synonyms: ANGPT4; angiopoietin 4; angiopoietin-4; ANG-4; angiopoietin-3; dJ824F16.2 (angiopoietin 4); AGP4; ANG4; ANG-3; MGC138181; MGC138183
• Gene ID: 51378
• mRNA Refseq: NM_015985
• Protein Refseq: NP_057069
• MIM: 603705
• UniProt ID: Q9Y264