Recombinant Human ANAPC1 protein, GST-tagged

• Cat.No.: ANAPC1-540H
• Product Overview: Human ANAPC1 partial ORF ( NP_073153, 1841 a.a. - 1944 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a subunit of the anaphase-promoting complex. This complex is an E3 ubiquitin ligase that regulates progression through the metaphase to anaphase portion of the cell cycle by ubiquitinating proteins which targets them for degradation. [provided by RefSeq, Dec 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.18 kDa
• AA Sequence: NSEFLPVVKCTIDNTLDQWLQVGGDMCVHAYLSGQPLEESQLSMLACFLVYHSVPAPQHLPPIGLEGSTSFAELLFKFKQLKMPVRALLRLAPLLLGNPQPMVM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANAPC1 anaphase promoting complex subunit 1 [ Homo sapiens ]
• Official Symbol: ANAPC1
• Synonyms: ANAPC1; anaphase promoting complex subunit 1; anaphase-promoting complex subunit 1; APC1; MCPR; TSG24; cyclosome subunit 1; mitotic checkpoint regulator; testis-specific gene 24 protein; anaphase-promoting complex 1 (meiotic checkpoint regulator)
• Gene ID: 64682
• mRNA Refseq: NM_022662
• Protein Refseq: NP_073153
• MIM: 608473
• UniProt ID: Q9H1A4