Recombinant Human AMY2B Protein, His-tagged
Cat.No. : | AMY2B-231H |
Product Overview : | Recombinant Human AMY2B fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
Molecular Mass : | 56.9kD |
AA Sequence : | QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKLVDHHHHHH* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | AMY2B amylase, alpha 2B (pancreatic) [ Homo sapiens ] |
Official Symbol | AMY2B |
Synonyms | AMY2B; amylase, alpha 2B (pancreatic); AMY2, amylase, alpha 2B; pancreatic; alpha-amylase 2B; glycogenase; alpha-amylase carcinoid; carcinoid alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase 2B; AMY2; |
Gene ID | 280 |
mRNA Refseq | NM_020978 |
Protein Refseq | NP_066188 |
MIM | 104660 |
UniProt ID | P19961 |
◆ Recombinant Proteins | ||
AMY2B-145R | Recombinant Rhesus Macaque AMY2B Protein, His (Fc)-Avi-tagged | +Inquiry |
AMY2B-294H | Recombinant Human AMY2B Protein, Fc-tagged | +Inquiry |
AMY2B-317R | Recombinant Rhesus AMY2B protein(Met1-Leu511), His-tagged | +Inquiry |
AMY2B-1032HF | Recombinant Full Length Human AMY2B Protein, GST-tagged | +Inquiry |
AMY2B-232H | Recombinant Human AMY2B protein (Met1-Leu511), His-tagged | +Inquiry |
◆ Native Proteins | ||
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMY2B-8873HCL | Recombinant Human AMY2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMY2B Products
Required fields are marked with *
My Review for All AMY2B Products
Required fields are marked with *
0
Inquiry Basket