Recombinant Human AMY2B protein, GST-tagged
Cat.No. : | AMY2B-536H |
Product Overview : | Human AMY2B full-length ORF ( NP_066188.1, 1 a.a. - 511 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the pancreas. [provided by RefSeq, Jun 2013] |
Molecular Mass : | 84.1 kDa |
AA Sequence : | MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMY2B amylase, alpha 2B (pancreatic) [ Homo sapiens ] |
Official Symbol | AMY2B |
Synonyms | AMY2B; amylase, alpha 2B (pancreatic); AMY2, amylase, alpha 2B; pancreatic; alpha-amylase 2B; glycogenase; alpha-amylase carcinoid; carcinoid alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase 2B; AMY2; |
Gene ID | 280 |
mRNA Refseq | NM_020978 |
Protein Refseq | NP_066188 |
MIM | 104660 |
UniProt ID | P19961 |
◆ Recombinant Proteins | ||
AMY2B-9630H | Recombinant Human AMY2B, His-tagged | +Inquiry |
AMY2B-232H | Recombinant Human AMY2B protein (Met1-Leu511), His-tagged | +Inquiry |
AMY2B-294H | Recombinant Human AMY2B Protein, Fc-tagged | +Inquiry |
AMY2B-145R | Recombinant Rhesus Macaque AMY2B Protein, His (Fc)-Avi-tagged | +Inquiry |
AMY2B-536H | Recombinant Human AMY2B protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMY2B-8873HCL | Recombinant Human AMY2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMY2B Products
Required fields are marked with *
My Review for All AMY2B Products
Required fields are marked with *
0
Inquiry Basket