Recombinant Human AMN1 protein, GST-tagged

• Cat.No.: AMN1-527H
• Product Overview: Human AMN1 full-length ORF ( NP_997220.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: AMN1 (Antagonist Of Mitotic Exit Network 1 Homolog) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 49.4 kDa
• AA Sequence: MQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AMN1 antagonist of mitotic exit network 1 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: AMN1
• Synonyms: AMN1; antagonist of mitotic exit network 1 homolog (S. cerevisiae); protein AMN1 homolog
• Gene ID: 196394
• mRNA Refseq: NM_001113402
• Protein Refseq: NP_001106873
• UniProt ID: Q8IY45