Recombinant Human AMBP protein, GST-tagged
Cat.No. : | AMBP-515H |
Product Overview : | Human AMBP full-length ORF ( AAH41593, 19 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 62.48 kDa |
AA Sequence : | AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMBP alpha-1-microglobulin/bikunin precursor [ Homo sapiens ] |
Official Symbol | AMBP |
Synonyms | AMBP; alpha-1-microglobulin/bikunin precursor; ITI, ITIL; protein AMBP; bikunin; complex forming glycoprotein heterogeneous in charge; EDC1; growth inhibiting protein 19; HCP; HI30; IATIL; inter alpha trypsin inhibitor light chain; ITILC; protein HC; trypstatin; uristatin; uronic acid rich protein; UTI; uronic-acid-rich protein; growth-inhibiting protein 19; inter-alpha-trypsin inhibitor light chain; complex-forming glycoprotein heterogeneous in charge; A1M; ITI; ITIL; |
Gene ID | 259 |
mRNA Refseq | NM_001633 |
Protein Refseq | NP_001624 |
MIM | 176870 |
UniProt ID | P02760 |
◆ Recombinant Proteins | ||
Ambp-225R | Recombinant Rat Ambp Protein, His-tagged | +Inquiry |
Ambp-223M | Recombinant Mouse Ambp Protein, His-tagged | +Inquiry |
AMBP-515H | Recombinant Human AMBP protein, GST-tagged | +Inquiry |
AMBP-127H | Recombinant Human AMBP Protein, His-tagged | +Inquiry |
AMBP-302R | Recombinant Rat AMBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
AMBP-27H | Native Human AMBP | +Inquiry |
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMBP-001HCL | Recombinant Human AMBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMBP Products
Required fields are marked with *
My Review for All AMBP Products
Required fields are marked with *
0
Inquiry Basket