Recombinant Human AMBP protein, GST-tagged

• Cat.No.: AMBP-515H
• Product Overview: Human AMBP full-length ORF ( AAH41593, 19 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 62.48 kDa
• AA Sequence: AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AMBP alpha-1-microglobulin/bikunin precursor [ Homo sapiens ]
• Official Symbol: AMBP
• Synonyms: AMBP; alpha-1-microglobulin/bikunin precursor; ITI, ITIL; protein AMBP; bikunin; complex forming glycoprotein heterogeneous in charge; EDC1; growth inhibiting protein 19; HCP; HI30; IATIL; inter alpha trypsin inhibitor light chain; ITILC; protein HC; trypstatin; uristatin; uronic acid rich protein; UTI; uronic-acid-rich protein; growth-inhibiting protein 19; inter-alpha-trypsin inhibitor light chain; complex-forming glycoprotein heterogeneous in charge; A1M; ITI; ITIL
• Gene ID: 259
• mRNA Refseq: NM_001633
• Protein Refseq: NP_001624
• MIM: 176870
• UniProt ID: P02760