Recombinant Human AMACR protein, GST-tagged

Cat.No. : AMACR-513H
Product Overview : Human AMACR full-length ORF ( AAH09471, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
Availability April 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. [provided by RefSeq, Mar 2011]
Molecular Mass : 47.52 kDa
AA Sequence : MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AMACR alpha-methylacyl-CoA racemase [ Homo sapiens ]
Official Symbol AMACR
Synonyms AMACR; alpha-methylacyl-CoA racemase; RACE; 2-methylacyl-CoA racemase; RM; CBAS4; AMACRD;
Gene ID 23600
mRNA Refseq NM_001167595
Protein Refseq NP_001161067
MIM 604489
UniProt ID Q9UHK6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AMACR Products

Required fields are marked with *

My Review for All AMACR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon