Recombinant Human AMACR, GST-tagged

• Cat.No.: AMACR-111H
• Product Overview: Recombinant Human AMACR (1 a.a. - 198 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.
• Molecular Mass: 47.52 kDa
• Sequence: MALQGISVMELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGGRNSMFKFFSVENSEIESVGSTSRTEHVGWWSTFLYDLQDSRWGIHGCWSNRTPVLRAADQRTWTKV
• Storagebuffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: AMACR

Gene Information

• Gene Name: AMACR alpha-methylacyl-CoA racemase [ Homo sapiens ]
• Synonyms: AMACR; RACE; CBAS4; AMACRD; alpha-methylacyl-CoA racemase; EC 5.1.99.4; 2-methylacyl-CoA racemase
• Gene ID: 23600
• mRNA Refseq: NM_014324
• Protein Refseq: NP_055139
• MIM: 604489
• UniProt ID: Q9UHK6
• Chromosome Location: 5p13
• Pathway: Metabolic pathways; Primary bile acid biosynthesis; Metabolism of lipids and lipoproteins
• Function: alpha-methylacyl-CoA racemase activity; receptor binding