Recombinant Human ALPI protein(291-370 aa), C-His-tagged

• Cat.No.: ALPI-2617H
• Product Overview: Recombinant Human ALPI protein(P09923)(291-370 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 291-370 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTL

Gene Information

• Gene Name: ALPI alkaline phosphatase, intestinal [ Homo sapiens ]
• Official Symbol: ALPI
• Synonyms: ALPI; alkaline phosphatase, intestinal; intestinal-type alkaline phosphatase; Kasahara isozyme; glycerophosphatase; alkaline phosphomonoesterase; intestinal alkaline phosphatase; IAP
• Gene ID: 248
• mRNA Refseq: NM_001631
• Protein Refseq: NP_001622
• MIM: 171740
• UniProt ID: P09923