Recombinant Human ALKBH3 Protein, GST-tagged
Cat.No. : | ALKBH3-2538H |
Product Overview : | Human DEPC-1 full-length ORF ( AAH15155, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-139 a.a. |
Description : | The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 41.03 kDa |
AA Sequence : | MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALKBH3 alkB, alkylation repair homolog 3 (E. coli) [ Homo sapiens ] |
Official Symbol | ALKBH3 |
Synonyms | ALKBH3; alkB, alkylation repair homolog 3 (E. coli); alpha-ketoglutarate-dependent dioxygenase alkB homolog 3; DEPC 1; prostate cancer antigen 1; prostate cancer antigen-1; alkylated DNA repair protein alkB homolog 3; ABH3; PCA1; DEPC1; DEPC-1; FLJ43614; MGC118790; MGC118792; MGC118793; |
Gene ID | 221120 |
mRNA Refseq | NM_139178 |
Protein Refseq | NP_631917 |
MIM | 610603 |
UniProt ID | Q96Q83 |
◆ Recombinant Proteins | ||
ALKBH3-2470HF | Recombinant Full Length Human ALKBH3 Protein, GST-tagged | +Inquiry |
ALKBH3-26501TH | Recombinant Human ALKBH3, His-tagged | +Inquiry |
ALKBH3-475M | Recombinant Mouse ALKBH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALKBH3-2538H | Recombinant Human ALKBH3 Protein, GST-tagged | +Inquiry |
ALKBH3-1555M | Recombinant Mouse ALKBH3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALKBH3-8901HCL | Recombinant Human ALKBH3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALKBH3 Products
Required fields are marked with *
My Review for All ALKBH3 Products
Required fields are marked with *
0
Inquiry Basket