Recombinant Human ALG6 Protein, GST-tagged
Cat.No. : | ALG6-466H |
Product Overview : | Human ALG6 partial ORF ( NP_037471, 25 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the first glucose residue to the growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations in this gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | SYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALG6 asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ALG6 |
Synonyms | ALG6; asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 6 homolog (yeast, alpha 1,3 glucosyltransferase); dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase; asparagine-linked glycosylation protein 6 homolog; Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase; dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase); CDG1C; |
Gene ID | 29929 |
mRNA Refseq | NM_013339 |
Protein Refseq | NP_037471 |
MIM | 604566 |
UniProt ID | Q9Y672 |
◆ Recombinant Proteins | ||
ALG6-1117Z | Recombinant Zebrafish ALG6 | +Inquiry |
ALG6-469M | Recombinant Mouse ALG6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALG6-466H | Recombinant Human ALG6 Protein, GST-tagged | +Inquiry |
ADAM10-2422H | Recombinant Human ADAM10 protein, GST-tagged | +Inquiry |
ALG6-6005C | Recombinant Chicken ALG6 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALG6 Products
Required fields are marked with *
My Review for All ALG6 Products
Required fields are marked with *
0
Inquiry Basket