Recombinant Human ALG13 protein, His-tagged

• Cat.No.: ALG13-9573H
• Product Overview: Recombinant Human ALG13 protein(1-165 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-165 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ALG13
• Synonyms: ALG13; asparagine-linked glycosylation 13 homolog (S. cerevisiae); chromosome X open reading frame 45 , CXorf45, GLT28D1, glycosyltransferase 28 domain containing 1; UDP-N-acetylglucosamine transferase subunit ALG13 homolog; FLJ23018; MDS031; YGL047W; glycosyltransferase 28 domain-containing protein 1; hematopoietic stem/progenitor cells protein MDS031; CXorf45; GLT28D1; FLJ31785; MGC12423
• Gene ID: 79868
• mRNA Refseq: NM_001039210
• Protein Refseq: NP_001034299
• MIM: 300776
• UniProt ID: Q9NP73