Recombinant Human AASDH Protein, GST-tagged

• Cat.No.: AASDH-024H
• Product Overview: Human AASDH full-length ORF ( AAH15096.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the non-ribosome peptide syntesase (NRPS) enzyme family. The encoded protein contains an AMP-binding domain, PP-binding (phosphopantetheine, or pantetheine 4'phosphate-binding) domain and the Pyrrolo-quinoline quinon (PQQ) binding domain. The protein is expressed in several adult tissues. [provided by RefSeq, Apr 2016]
• Molecular Mass: 41.7 kDa
• AA Sequence: MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AASDH aminoadipate-semialdehyde dehydrogenase [ Homo sapiens ]
• Official Symbol: AASDH
• Synonyms: AASDH; aminoadipate-semialdehyde dehydrogenase; acyl-CoA synthetase family member 4; ACSF4; acyl CoA synthetase family member 4; LYS2; NRPS998; non-ribosomal peptide synthetase 998; non-ribosomal peptide synthetase 1098; 2-aminoadipic 6-semialdehyde dehydrogenase; NRPS1098
• Gene ID: 132949
• mRNA Refseq: NM_181806
• Protein Refseq: NP_861522
• MIM: 614365
• UniProt ID: Q4L235