Recombinant Human ALAS1 Protein, GST-tagged

• Cat.No.: ALAS1-429H
• Product Overview: Human ALAS1 partial ORF ( NP_000679, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the mitochondrial enzyme which is catalyzes the rate-limiting step in heme (iron-protoporphyrin) biosynthesis. The enzyme encoded by this gene is the housekeeping enzyme; a separate gene encodes a form of the enzyme that is specific for erythroid tissue. The level of the mature encoded protein is regulated by heme: high levels of heme down-regulate the mature enzyme in mitochondria while low heme levels up-regulate. A pseudogene of this gene is located on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.52 kDa
• AA Sequence: MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALAS1 aminolevulinate, delta-, synthase 1 [ Homo sapiens ]
• Official Symbol: ALAS1
• Synonyms: ALAS1; aminolevulinate, delta-, synthase 1; ALAS, ALAS3; 5-aminolevulinate synthase, nonspecific, mitochondrial; ALAS-H; delta-ALA synthase 1; migration-inducing protein 4; 5-aminolevulinic acid synthase 1; delta-aminolevulinate synthase 1; ALAS; MIG4; ALAS3; ALASH
• Gene ID: 211
• mRNA Refseq: NM_000688
• Protein Refseq: NP_000679
• MIM: 125290
• UniProt ID: P13196