Recombinant Human ALAS1

Description :	Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2 (MIM 301300).
Protein length :	98 amino acids
Molecular Weight :	36.410kDa inclusive of tags
Source :	Wheat germ
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
Sequence Similarities :	Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Tag :	Non

Gene Name	ALAS1 aminolevulinate, delta-, synthase 1 [ Homo sapiens ]
Official Symbol	ALAS1
Synonyms	ALAS1; aminolevulinate, delta-, synthase 1; ALAS, ALAS3; 5-aminolevulinate synthase, nonspecific, mitochondrial;
Gene ID	211
mRNA Refseq	NM_000688
Protein Refseq	NP_000679
MIM	125290
Uniprot ID	P13196
Chromosome Location	3p21
Pathway	FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem; Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem;
Function	5-aminolevulinate synthase activity; pyridoxal phosphate binding; transferase activity, transferring acyl groups; transferase activity, transferring nitrogenous groups;