Recombinant Human ALAS1

• Cat.No.: ALAS1-26883TH
• Product Overview: Recombinant fragment of Human Alas1 with N terminal proprietary tag, 36.41kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: Delta-aminolevulinate synthase (ALAS; EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2 (MIM 301300).
• Molecular Weight: 36.410kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
• Sequence Similarities: Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.

Gene Information

• Gene Name: ALAS1 aminolevulinate, delta-, synthase 1 [ Homo sapiens ]
• Official Symbol: ALAS1
• Synonyms: ALAS1; aminolevulinate, delta-, synthase 1; ALAS, ALAS3; 5-aminolevulinate synthase, nonspecific, mitochondrial
• Gene ID: 211
• mRNA Refseq: NM_000688
• Protein Refseq: NP_000679
• MIM: 125290
• Uniprot ID: P13196
• Chromosome Location: 3p21
• Pathway: FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem; Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem
• Function: 5-aminolevulinate synthase activity; pyridoxal phosphate binding; transferase activity, transferring acyl groups; transferase activity, transferring nitrogenous groups