Recombinant Human AKAP13 Protein, GST-tagged

• Cat.No.: AKAP13-399H
• Product Overview: Human AKAP13 partial ORF ( NP_006729, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms containing c-terminal dbl oncogene homology (DH) and pleckstrin homology (PH) domains. The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins, resulting in the conversion of the inactive GTPase to the active form capable of transducing signals. The PH domain has multiple functions. Therefore, these isoforms function as scaffolding proteins to coordinate a Rho signaling pathway, function as protein kinase A-anchoring proteins and, in addition, enhance ligand-dependent activity of estrogen receptors alpha and beta. [provided by RefSeq, Jul 2012]
• Molecular Mass: 37.84 kDa
• AA Sequence: MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKAP13 A kinase (PRKA) anchor protein 13 [ Homo sapiens ]
• Official Symbol: AKAP13
• Synonyms: AKAP13; A kinase (PRKA) anchor protein 13; LBC, lymphoid blast crisis oncogene; A-kinase anchor protein 13; AKAP Lbc; ARHGEF13; BRX; c lbc; HA 3; Ht31; PROTO LB; p47; AKAP-13; LBC oncogene; A-kinase anchoring protein; lymphoid blast crisis oncogene; human thyroid-anchoring protein 31; protein kinase A-anchoring protein 13; guanine nucleotide exchange factor Lbc; non-oncogenic Rho GTPase-specific GTP exchange factor; breast cancer nuclear receptor-binding auxiliary protein; LBC; HA-3; c-lbc; PRKA13; AKAP-Lbc; PROTO-LB; PROTO-LBC; FLJ11952; FLJ43341
• Gene ID: 11214
• mRNA Refseq: NM_006738
• Protein Refseq: NP_006729
• MIM: 604686
• UniProt ID: Q12802