Recombinant Human AKAP12 protein(421-530 aa), C-His-tagged

• Cat.No.: AKAP12-2822H
• Product Overview: Recombinant Human AKAP12 protein(Q02952)(421-530 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 421-530 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSG
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: AKAP12 A kinase (PRKA) anchor protein 12 [ Homo sapiens ]
• Official Symbol: AKAP12
• Synonyms: AKAP12; A kinase (PRKA) anchor protein 12; A kinase (PRKA) anchor protein (gravin) 12; A-kinase anchor protein 12; AKAP250; gravin; Src Suppressed C Kinase Substrate; SSeCKS; AKAP 250; kinase scaffold protein gravin; A-kinase anchor protein, 250kDa; Src-Suppressed C Kinase Substrate; myasthenia gravis autoantigen gravin; FLJ20945; FLJ97621; DKFZp686M0430; DKFZp686O0331
• Gene ID: 9590
• mRNA Refseq: NM_005100
• Protein Refseq: NP_005091
• MIM: 604698
• UniProt ID: Q02952