Recombinant Human AKAP11 Protein, GST-tagged
Cat.No. : | AKAP11-397H |
Product Overview : | Human AKAP11 partial ORF ( NP_057332, 1801 a.a. - 1901 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein is expressed at high levels throughout spermatogenesis and in mature sperm. It binds the RI and RII subunits of PKA in testis. It may serve a function in cell cycle control of both somatic cells and germ cells in addition to its putative role in spermatogenesis and sperm function. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.85 kDa |
AA Sequence : | EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKAP11 A-kinase anchoring protein 11 [ Homo sapiens (human) ] |
Official Symbol | AKAP11 |
Synonyms | AKAP11; A-kinase anchoring protein 11; PRKA11; AKAP-11; AKAP220; PPP1R44; A-kinase anchor protein 11; A kinase (PRKA) anchor protein 11; A-kinase anchor protein 220 kDa; A-kinase anchoring protein, 220kDa; a kinase anchor protein 220 kDa; protein kinase A anchoring protein 11; protein phosphatase 1, regulatory subunit 44 |
Gene ID | 11215 |
mRNA Refseq | NM_016248 |
Protein Refseq | NP_057332 |
MIM | 604696 |
UniProt ID | Q9UKA4 |
◆ Recombinant Proteins | ||
ACLY-2292H | Recombinant Human ACLY protein, His-tagged | +Inquiry |
AKAP11-395H | Recombinant Human AKAP11 Protein, His-tagged | +Inquiry |
AKAP11-397H | Recombinant Human AKAP11 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKAP11 Products
Required fields are marked with *
My Review for All AKAP11 Products
Required fields are marked with *
0
Inquiry Basket