Recombinant Human AKAP1 Protein, GST-tagged

• Cat.No.: AKAP1-395H
• Product Overview: Human AKAP1 partial ORF ( NP_003479, 806 a.a. - 903 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.52 kDa
• AA Sequence: VLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKAP1 A kinase (PRKA) anchor protein 1 [ Homo sapiens ]
• Official Symbol: AKAP1
• Synonyms: AKAP1; A kinase (PRKA) anchor protein 1; PRKA1; A-kinase anchor protein 1, mitochondrial; AKAP84; AKAP121; AKAP149; D AKAP1; dual specificity A kinase anchoring protein 1; PPP1R43; protein kinase anchoring protein 1; protein phosphatase 1; regulatory subunit 43; S AKAP84; SAKAP84; AKAP 149; D-AKAP-1; protein kinase A1; A-kinase anchor protein 149 kDa; protein kinase A anchoring protein 1; spermatid A-kinase anchor protein 84; protein phosphatase 1, regulatory subunit 43; dual-specificity A-kinase anchoring protein 1; AKAP; D-AKAP1; MGC1807
• Gene ID: 8165
• mRNA Refseq: NM_001242902
• Protein Refseq: NP_001229831
• MIM: 602449
• UniProt ID: Q92667