Recombinant Human AKAP1 Protein, GST-tagged
Cat.No. : | AKAP1-395H |
Product Overview : | Human AKAP1 partial ORF ( NP_003479, 806 a.a. - 903 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | VLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKAP1 A kinase (PRKA) anchor protein 1 [ Homo sapiens ] |
Official Symbol | AKAP1 |
Synonyms | AKAP1; A kinase (PRKA) anchor protein 1; PRKA1; A-kinase anchor protein 1, mitochondrial; AKAP84; AKAP121; AKAP149; D AKAP1; dual specificity A kinase anchoring protein 1; PPP1R43; protein kinase anchoring protein 1; protein phosphatase 1; regulatory subunit 43; S AKAP84; SAKAP84; AKAP 149; D-AKAP-1; protein kinase A1; A-kinase anchor protein 149 kDa; protein kinase A anchoring protein 1; spermatid A-kinase anchor protein 84; protein phosphatase 1, regulatory subunit 43; dual-specificity A-kinase anchoring protein 1; AKAP; D-AKAP1; MGC1807; |
Gene ID | 8165 |
mRNA Refseq | NM_001242902 |
Protein Refseq | NP_001229831 |
MIM | 602449 |
UniProt ID | Q92667 |
◆ Recombinant Proteins | ||
Akap1-3019R | Recombinant Rat Akap1, His-tagged | +Inquiry |
AKAP1-425M | Recombinant Mouse AKAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKAP1-243R | Recombinant Rat AKAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKAP1-395H | Recombinant Human AKAP1 Protein, GST-tagged | +Inquiry |
AKAP1-587R | Recombinant Rat AKAP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP1-8942HCL | Recombinant Human AKAP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKAP1 Products
Required fields are marked with *
My Review for All AKAP1 Products
Required fields are marked with *
0
Inquiry Basket