Recombinant Human AKAP1 Protein, GST-tagged

Cat.No. : AKAP1-395H
Product Overview : Human AKAP1 partial ORF ( NP_003479, 806 a.a. - 903 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The encoded protein binds to type I and type II regulatory subunits of PKA and anchors them to the mitochondrion. This protein is speculated to be involved in the cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.52 kDa
AA Sequence : VLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSPEADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKAP1 A kinase (PRKA) anchor protein 1 [ Homo sapiens ]
Official Symbol AKAP1
Synonyms AKAP1; A kinase (PRKA) anchor protein 1; PRKA1; A-kinase anchor protein 1, mitochondrial; AKAP84; AKAP121; AKAP149; D AKAP1; dual specificity A kinase anchoring protein 1; PPP1R43; protein kinase anchoring protein 1; protein phosphatase 1; regulatory subunit 43; S AKAP84; SAKAP84; AKAP 149; D-AKAP-1; protein kinase A1; A-kinase anchor protein 149 kDa; protein kinase A anchoring protein 1; spermatid A-kinase anchor protein 84; protein phosphatase 1, regulatory subunit 43; dual-specificity A-kinase anchoring protein 1; AKAP; D-AKAP1; MGC1807;
Gene ID 8165
mRNA Refseq NM_001242902
Protein Refseq NP_001229831
MIM 602449
UniProt ID Q92667

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AKAP1 Products

Required fields are marked with *

My Review for All AKAP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon