Recombinant Human AIP Protein, GST-tagged

• Cat.No.: AIP-479H
• Product Overview: Human AIP partial ORF ( NP_003968.1, 156 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]
• Molecular Mass: 36.08 kDa
• AA Sequence: KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AIP aryl hydrocarbon receptor interacting protein [ Homo sapiens ]
• Official Symbol: AIP
• Synonyms: AIP; aryl hydrocarbon receptor interacting protein; AH receptor-interacting protein; ARA9; FKBP16; XAP2; immunophilin homolog ARA9; HBV X-associated protein 2; XAP-2; FKBP37; SMTPHN
• Gene ID: 9049
• mRNA Refseq: NM_003977
• Protein Refseq: NP_003968
• MIM: 605555
• UniProt ID: O00170