Recombinant Human AIMP1 protein
Cat.No. : | AIMP1-87H |
Product Overview : | Recombinant Human AIMP1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 166 |
Description : | Endothelial-Monocyte Activating Polypeptide II (EMAP-II) is a tumor derived cytokine that exerts a wide range of activities on endothelial cells, monocytes and neutrophils. EMAP-II inhibits endothelial cell proliferation, vasculogenesis, neovessel formation, and can induce apoptosis. It is also chemotactic towards neutrophils and monocytes and induces myeloperoxidase activity from neutrophils. Of clinical importance, EMAP-II inhibits angiogenesis of vascular beds and suppresses the growth of primary and secondary tumors without affecting normal tissues. Mature EMAP-II is an 18.3 kDa protein, which is synthesized as the C-terminal portion of a biologically inactive precursor protein containing a propeptide of 146 amino acid residues. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the apoptotic effect using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg. |
Molecular Mass : | Approximately 18.2 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids. |
AA Sequence : | SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK |
Endotoxin : | Less than 1 EU/μg of rHuEMAP-II as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | AIMP1 |
Official Symbol | AIMP1 |
Synonyms | AIMP1; aminoacyl tRNA synthetase complex-interacting multifunctional protein 1; SCYE1, small inducible cytokine subfamily E, member 1 (endothelial monocyte activating); aminoacyl tRNA synthase complex-interacting multifunctional protein 1; ARS interacting multifunctional protein 1; EMAP II; EMAP 2; EMAPII; p43; ARS-interacting multifunctional protein 1; endothelial monocyte-activating polypeptide 2; multisynthase complex auxiliary component p43; endothelial-monocyte activating polypeptide II; multisynthetase complex auxiliary component p43; small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating); HLD3; EMAP2; SCYE1; |
Gene ID | 9255 |
mRNA Refseq | NM_001142415 |
Protein Refseq | NP_001135887 |
MIM | 603605 |
UniProt ID | Q12904 |
◆ Recombinant Proteins | ||
AIMP1-940H | Recombinant Human AIMP1, His-tagged | +Inquiry |
AIMP1-0444H | Recombinant Human AIMP1 Protein (Lys148-Lys312), N-His-tagged | +Inquiry |
AIMP1-865G | Recombinant Human Aminoacyl tRNA Synthetase Complex-interacting Multifunctional Protein 1, His-tagged | +Inquiry |
Aimp1-7399M | Recombinant Mouse Aimp1 protein | +Inquiry |
SCYE1-2547H | Recombinant Human SCYE1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIMP1-578HCL | Recombinant Human AIMP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIMP1 Products
Required fields are marked with *
My Review for All AIMP1 Products
Required fields are marked with *
0
Inquiry Basket