Recombinant Human AIMP1 protein

• Cat.No.: AIMP1-87H
• Product Overview: Recombinant Human AIMP1 protein was expressed in Escherichia coli.

Specification

• Description: Endothelial-Monocyte Activating Polypeptide II (EMAP-II) is a tumor derived cytokine that exerts a wide range of activities on endothelial cells, monocytes and neutrophils. EMAP-II inhibits endothelial cell proliferation, vasculogenesis, neovessel formation, and can induce apoptosis. It is also chemotactic towards neutrophils and monocytes and induces myeloperoxidase activity from neutrophils. Of clinical importance, EMAP-II inhibits angiogenesis of vascular beds and suppresses the growth of primary and secondary tumors without affecting normal tissues. Mature EMAP-II is an 18.3 kDa protein, which is synthesized as the C-terminal portion of a biologically inactive precursor protein containing a propeptide of 146 amino acid residues.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by the apoptotic effect using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg.
• Molecular Mass: Approximately 18.2 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids.
• Protein length: 166
• AA Sequence: SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
• Endotoxin: Less than 1 EU/μg of rHuEMAP-II as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: AIMP1
• Official Symbol: AIMP1
• Synonyms: AIMP1; aminoacyl tRNA synthetase complex-interacting multifunctional protein 1; SCYE1, small inducible cytokine subfamily E, member 1 (endothelial monocyte activating); aminoacyl tRNA synthase complex-interacting multifunctional protein 1; ARS interacting multifunctional protein 1; EMAP II; EMAP 2; EMAPII; p43; ARS-interacting multifunctional protein 1; endothelial monocyte-activating polypeptide 2; multisynthase complex auxiliary component p43; endothelial-monocyte activating polypeptide II; multisynthetase complex auxiliary component p43; small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating); HLD3; EMAP2; SCYE1
• Gene ID: 9255
• mRNA Refseq: NM_001142415
• Protein Refseq: NP_001135887
• MIM: 603605
• UniProt ID: Q12904