Active Recombinant Human AIMP1 Protein (166 aa)

Cat.No. : AIMP1-130A
Product Overview : Recombinant Human AIMP1 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 166
Description : EMAP-II is a tumor derived cytokine that exerts a wide range of activities on endothelial cells, monocytes and neutrophils. EMAP-II inhibits endothelial cell proliferation, vasculogenesis, neovessel formation, and can induce apoptosis. It is also chemotactic towards neutrophils and monocytes and induces myeloperoxidase activity from neutrophils. Of clinical importance, EMAP-II inhibits angiogenesis of vascular beds and suppresses the growth of primary and secondary tumors without affecting normal tissues. Mature EMAP-II is an 18.3 kDa protein, which is synthesized as the C-terminal portion of a biologically inactive precursor protein containing a propeptide of 146 amino acid residues.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Determined by the apoptotic effect on MCF-7 cells using a concentration of 20-40 ng/mL, corresponding to a Specific Activity of >2.5 × 10^4 IU/mg.
Molecular Mass : Approximately 18.3 KDa, a single non-glycosylated polypeptide chain containing 166 amino acids.
AA Sequence : SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Endotoxin : Less than 1 EU/mg of rHuEMAP-II as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name AIMP1 aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [ Homo sapiens (human) ]
Official Symbol AIMP1
Synonyms AIMP1; aminoacyl tRNA synthetase complex interacting multifunctional protein 1; p43; HLD3; EMAP2; SCYE1; EMAPII;
Gene ID 9255
mRNA Refseq NM_004757
Protein Refseq NP_004748
MIM 603605
UniProt ID Q12904

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AIMP1 Products

Required fields are marked with *

My Review for All AIMP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon