Active Recombinant Human AIMP1 Protein (166 aa)
Cat.No. : | AIMP1-130A |
Product Overview : | Recombinant Human AIMP1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 166 |
Description : | EMAP-II is a tumor derived cytokine that exerts a wide range of activities on endothelial cells, monocytes and neutrophils. EMAP-II inhibits endothelial cell proliferation, vasculogenesis, neovessel formation, and can induce apoptosis. It is also chemotactic towards neutrophils and monocytes and induces myeloperoxidase activity from neutrophils. Of clinical importance, EMAP-II inhibits angiogenesis of vascular beds and suppresses the growth of primary and secondary tumors without affecting normal tissues. Mature EMAP-II is an 18.3 kDa protein, which is synthesized as the C-terminal portion of a biologically inactive precursor protein containing a propeptide of 146 amino acid residues. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by the apoptotic effect on MCF-7 cells using a concentration of 20-40 ng/mL, corresponding to a Specific Activity of >2.5 × 10^4 IU/mg. |
Molecular Mass : | Approximately 18.3 KDa, a single non-glycosylated polypeptide chain containing 166 amino acids. |
AA Sequence : | SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK |
Endotoxin : | Less than 1 EU/mg of rHuEMAP-II as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | AIMP1 aminoacyl tRNA synthetase complex interacting multifunctional protein 1 [ Homo sapiens (human) ] |
Official Symbol | AIMP1 |
Synonyms | AIMP1; aminoacyl tRNA synthetase complex interacting multifunctional protein 1; p43; HLD3; EMAP2; SCYE1; EMAPII; |
Gene ID | 9255 |
mRNA Refseq | NM_004757 |
Protein Refseq | NP_004748 |
MIM | 603605 |
UniProt ID | Q12904 |
◆ Cell & Tissue Lysates | ||
AIMP1-578HCL | Recombinant Human AIMP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIMP1 Products
Required fields are marked with *
My Review for All AIMP1 Products
Required fields are marked with *
0
Inquiry Basket