Recombinant Human AIFM2 Protein, GST-tagged

• Cat.No.: AIFM2-474H
• Product Overview: Human AIFM2 full-length ORF ( NP_116186.1, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010]
• Molecular Mass: 66.9 kDa
• AA Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AIFM2 apoptosis-inducing factor, mitochondrion-associated, 2 [ Homo sapiens ]
• Official Symbol: AIFM2
• Synonyms: AIFM2; apoptosis-inducing factor, mitochondrion-associated, 2; AMID, apoptosis inducing factor (AIF) like mitochondrion associated inducer of death; apoptosis-inducing factor 2; FLJ14497; PRG3; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; AMID; RP11-367H5.2; DKFZp686L1298
• Gene ID: 84883
• mRNA Refseq: NM_032797
• Protein Refseq: NP_116186
• MIM: 605159
• UniProt ID: Q9BRQ8