Recombinant Human AIFM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | AIFM2-1266H |
Product Overview : | AIFM2 MS Standard C13 and N15-labeled recombinant protein (NP_116186) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AIFM2 apoptosis inducing factor mitochondria associated 2 [ Homo sapiens (human) ] |
Official Symbol | AIFM2 |
Synonyms | AIFM2; apoptosis-inducing factor, mitochondrion-associated, 2; AMID, apoptosis inducing factor (AIF) like mitochondrion associated inducer of death; apoptosis-inducing factor 2; FLJ14497; PRG3; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death; AMID; RP11-367H5.2; DKFZp686L1298; |
Gene ID | 84883 |
mRNA Refseq | NM_032797 |
Protein Refseq | NP_116186 |
MIM | 605159 |
UniProt ID | Q9BRQ8 |
◆ Recombinant Proteins | ||
AIFM2-956HF | Recombinant Full Length Human AIFM2 Protein, GST-tagged | +Inquiry |
AIFM2-412M | Recombinant Mouse AIFM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AIFM2-474H | Recombinant Human AIFM2 Protein, GST-tagged | +Inquiry |
AIFM2-1452M | Recombinant Mouse AIFM2 Protein | +Inquiry |
RFL10621XF | Recombinant Full Length Xenopus Laevis Apoptosis-Inducing Factor 2(Aifm2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIFM2-8953HCL | Recombinant Human AIFM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIFM2 Products
Required fields are marked with *
My Review for All AIFM2 Products
Required fields are marked with *
0
Inquiry Basket