Recombinant Human AIDA Protein, GST-tagged

• Cat.No.: AIDA-4240H
• Product Overview: Human FLJ12806 full-length ORF ( AAH15535, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: AIDA (Axin Interactor, Dorsalization Associated) is a Protein Coding gene. GO annotations related to this gene include protein domain specific binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.4 kDa
• AA Sequence: MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AIDA axin interactor, dorsalization associated [ Homo sapiens ]
• Official Symbol: AIDA
• Synonyms: AIDA; axin interactor, dorsalization associated; C1orf80, chromosome 1 open reading frame 80; axin interactor, dorsalization-associated protein; axin interaction partner and dorsalization antagonist; FLJ12806; C1orf80; FLJ32421; RP11-378J18.7
• Gene ID: 64853
• mRNA Refseq: NM_022831
• Protein Refseq: NP_073742
• MIM: 612375
• UniProt ID: Q96BJ3