Recombinant Human AIDA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AIDA-841H
• Product Overview: AIDA MS Standard C13 and N15-labeled recombinant protein (NP_073742) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Acts as a ventralizing factor during embryogenesis. Inhibits axin-mediated JNK activation by binding axin and disrupting axin homodimerization. This in turn antagonizes a Wnt/beta-catenin-independent dorsalization pathway activated by AXIN/JNK-signaling.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 35 kDa
• AA Sequence: MSEVTRSLLQRWGASFRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPVPLRRILAPGEEENLEFEEDEEEGGAGAGSPDSFPARVPGTLLPRLPSEPGMTLLTIRIEKIGLKDAGQCIDPYITVSVKDLNGIDLTPVQDTPVASRKEDTYVHFNVDIELQKHVEKLTKGAAIFFEFKHYKPKKRFTSTKCFAFMEMDEIKPGPIVIELYKKPTDFKRKKLQLLTKKPLYLHLHQTLHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AIDA axin interactor, dorsalization associated [ Homo sapiens (human) ]
• Official Symbol: AIDA
• Synonyms: AIDA; axin interactor, dorsalization associated; C1orf80, chromosome 1 open reading frame 80; axin interactor, dorsalization-associated protein; axin interaction partner and dorsalization antagonist; FLJ12806; C1orf80; FLJ32421; RP11-378J18.7
• Gene ID: 64853
• mRNA Refseq: NM_022831
• Protein Refseq: NP_073742
• MIM: 612375
• UniProt ID: Q96BJ3