Recombinant Human AHSA1 Protein, GST-tagged

Cat.No. : AHRR-466H
Product Overview : Human AHRR partial ORF ( NP_065782, 617 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene participates in the aryl hydrocarbon receptor (AhR) signaling cascade, which mediates dioxin toxicity, and is involved in regulation of cell growth and differentiation. It functions as a feedback modulator by repressing AhR-dependent gene expression. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jun 2011]
Molecular Mass : 36.63 kDa
AA Sequence : RATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AHRR aryl-hydrocarbon receptor repressor [ Homo sapiens ]
Official Symbol AHRR
Synonyms AHRR; aryl-hydrocarbon receptor repressor; AHH, AHHR, aryl hydrocarbon receptor regulator; aryl hydrocarbon receptor repressor; bHLHe77; KIAA1234; ahR repressor; dioxin receptor repressor; aryl hydrocarbon hydroxylase regulator; class E basic helix-loop-helix protein 77; AHH; AHHR; MGC167813; MGC176630;
Gene ID 57491
mRNA Refseq NM_001242412
Protein Refseq NP_001229341
MIM 606517
UniProt ID A9YTQ3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AHRR Products

Required fields are marked with *

My Review for All AHRR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon