Recombinant Human AHDC1 Protein, GST-tagged

• Cat.No.: AHCYL1-457H
• Product Overview: Human AHCYL1 partial ORF ( NP_006612, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene interacts with inositol 1,4,5-trisphosphate receptor, type 1 and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.85 kDa
• AA Sequence: MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AHCYL1 adenosylhomocysteinase-like 1 [ Homo sapiens ]
• Official Symbol: AHCYL1
• Synonyms: AHCYL1; adenosylhomocysteinase-like 1; S adenosylhomocysteine hydrolase like 1; putative adenosylhomocysteinase 2; inositol 1; 4; 5 trisphosphate receptor binding protein; IRBIT; XPVKONA; adoHcyase 2; DC-expressed AHCY-like molecule; S-adenosyl-L-homocysteine hydrolase 2; S-adenosyl homocysteine hydrolase homolog; dendritic cell expressed AHCY-like protein; S-adenosylhomocysteine hydrolase-like protein 1; inositol 1,4,5-trisphosphate receptor-binding protein; DCAL; PRO0233
• Gene ID: 10768
• mRNA Refseq: NM_001242673
• Protein Refseq: NP_001229602
• MIM: 607826
• UniProt ID: O43865