Recombinant Human AHDC1 Protein, GST-tagged
Cat.No. : | AHCYL1-457H |
Product Overview : | Human AHCYL1 partial ORF ( NP_006612, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene interacts with inositol 1,4,5-trisphosphate receptor, type 1 and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Molecular Mass : | 36.85 kDa |
AA Sequence : | MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AHCYL1 adenosylhomocysteinase-like 1 [ Homo sapiens ] |
Official Symbol | AHCYL1 |
Synonyms | AHCYL1; adenosylhomocysteinase-like 1; S adenosylhomocysteine hydrolase like 1; putative adenosylhomocysteinase 2; inositol 1; 4; 5 trisphosphate receptor binding protein; IRBIT; XPVKONA; adoHcyase 2; DC-expressed AHCY-like molecule; S-adenosyl-L-homocysteine hydrolase 2; S-adenosyl homocysteine hydrolase homolog; dendritic cell expressed AHCY-like protein; S-adenosylhomocysteine hydrolase-like protein 1; inositol 1,4,5-trisphosphate receptor-binding protein; DCAL; PRO0233; |
Gene ID | 10768 |
mRNA Refseq | NM_001242673 |
Protein Refseq | NP_001229602 |
MIM | 607826 |
UniProt ID | O43865 |
◆ Recombinant Proteins | ||
AHCYL1-11441Z | Recombinant Zebrafish AHCYL1 | +Inquiry |
AHCYL1-295H | Recombinant Human AHCYL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AHCYL1-456H | Recombinant Human AHCYL1 Protein, GST-tagged | +Inquiry |
AHCYL1-8459H | Recombinant Human AHCYL1, His-tagged | +Inquiry |
AHCYL1-457H | Recombinant Human AHDC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHCYL1-39HCL | Recombinant Human AHCYL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHCYL1 Products
Required fields are marked with *
My Review for All AHCYL1 Products
Required fields are marked with *
0
Inquiry Basket