Recombinant Human AGTRAP protein, GST-tagged

• Cat.No.: AGTRAP-16H
• Product Overview: Recombinant Human AGTRAP(1 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.1 kDa
• Protein length: 1 a.a. - 152 a.a.
• AA Sequence: MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIVHISIF YPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDAR GY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: AGTRAP angiotensin II receptor-associated protein [ Homo sapiens ]
• Official Symbol: AGTRAP
• Synonyms: AGTRAP; angiotensin II receptor-associated protein; type-1 angiotensin II receptor-associated protein; ATRAP; AT1 receptor-associated protein; ATI receptor-associated protein; angiotensin II, type I receptor-associated protein; MGC29646
• Gene ID: 57085
• mRNA Refseq: NM_001040194
• Protein Refseq: NP_001035284
• MIM: 608729
• UniProt ID: Q6RW13
• Chromosome Location: 1p36.22
• Function: angiotensin type II receptor activity; protein binding